SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG11858_3prime_partial:A_BomoMSG_c23483_g1_i1
Scaffold_idBomo_Chr18
NCBI non-redundant
(nr)
sortilin-related_receptor_isoform_X4_[Helicoverpa_armigera]
Ontology
GO:0000042 P protein localization to Golgi apparatus
GO:0001540 F amyloid-beta binding
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0005641 C nuclear envelope lumen
GO:0005768 C endosome
GO:0005769 C early endosome
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005802 C trans-Golgi network
GO:0006605 P protein targeting
GO:0006622 P protein targeting to lysosome
GO:0006629 P lipid metabolic process
GO:0006810 P transport
GO:0006869 P lipid transport
GO:0006892 P post-Golgi vesicle-mediated transport
GO:0006897 P endocytosis
GO:0007275 P multicellular organism development
GO:0008202 P steroid metabolic process
GO:0008203 P cholesterol metabolic process
GO:0014910 P regulation of smooth muscle cell migration
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030169 F low-density lipoprotein particle binding
GO:0030306 F small GTPase binding
GO:0031985 C Golgi cisterna
GO:0032091 P negative regulation of protein binding
GO:0032460 P negative regulation of protein oligomerization
GO:0034362 C low-density lipoprotein particle
GO:0043407 P negative regulation of MAP kinase activity
GO:0045053 P protein retention in Golgi apparatus
GO:0045732 P positive regulation of protein catabolic process
GO:0048471 C perinuclear region of cytoplasm
GO:0050768 P negative regulation of neurogenesis
GO:0051604 P protein maturation
GO:0055037 C recycling endosome
GO:0070062 C extracellular exosome
GO:0070863 P positive regulation of protein exit from endoplasmic reticulum
GO:1901215 P negative regulation of neuron death
GO:1902430 P negative regulation of amyloid-beta formation
GO:1902771 P positive regulation of choline O-acetyltransferase activity
GO:1902948 P negative regulation of tau-protein kinase activity
GO:1902953 P positive regulation of ER to Golgi vesicle-mediated transport
GO:1902955 P positive regulation of early endosome to recycling endosome transport
GO:1902960 P negative regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process
GO:1902963 P negative regulation of metalloendopeptidase activity involved in amyloid precursor protein catabolic process
GO:1902966 P positive regulation of protein localization to early endosome
GO:1902997 P negative regulation of neurofibrillary tangle assembly
GO:2001137 P positive regulation of endocytic recycling
RNA-seq EntryA_BomoMSG_c23483_g1_i1
Sequence
(Amino Acid)
MLLAFNRVFFVLILYLISCVSYCEQYGEFENTLYVSEDVSKSDRRMTVINRFTENESSGS
YRRKREATTVQPVQGNVSTQITHLNDSHQQLMVHWVGEGSNVIICLARDSIPRNKGVISP
SALFISYDYGKTFMNKTESFKLGDTSNNGYAQLDKFFNHPKYPEFCVFVDSTNKKLYYTS
DNGRNIHRSDLTFSPSELAFDEEFPDKYVILDKVDINRKLYLTLDGGKTFKMIQSFVKTF
VWSSGPGFSKVFYVERWKPDGTSAVLSASDPTDLINAEVLFEETKDFQVKGDYMFATKQS
KEKNTLHLYISHQRGPFYKAEFETELNLRKFHIADVTDSRIFVSVMHTDTLANLYVSEIG
RNFTQYNFVLSMEQILCYFPEGNWKDSWLEDVTE
(130 a.a.)

- SilkBase 1999-2023 -