SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG1182_internal:A_BomoMSG_c5490_g1_i1
Scaffold_idBomo_Chr25
NCBI non-redundant
(nr)		potassium_channel_subfamily_K_member_9_[Bombyx_mori]
Ontology
GO:0005216 F ion channel activity
GO:0005252 F open rectifier potassium channel activity
GO:0005267 F potassium channel activity
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006813 P potassium ion transport
GO:0007420 P brain development
GO:0008022 F protein C-terminus binding
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0022841 F potassium ion leak channel activity
GO:0030322 P stabilization of membrane potential
GO:0034220 P ion transmembrane transport
GO:0042493 P response to xenobiotic stimulus
GO:0042803 F protein homodimerization activity
GO:0044548 F S100 protein binding
GO:0046982 F protein heterodimerization activity
GO:0051481 P negative regulation of cytosolic calcium ion concentration
GO:0071294 P cellular response to zinc ion
GO:0071456 P cellular response to hypoxia
GO:0071805 P potassium ion transmembrane transport
GO:0090102 P cochlea development
GO:0098779 P positive regulation of mitophagy in response to mitochondrial depolarization
RNA-seq EntryA_BomoMSG_c5490_g1_i1
Sequence
(Amino Acid)
GHSTPVTVGGKAFCMAYAMVGIPLGLVMFQSIGERLNKFASVVIRRAKCYLRCNTTEATE
MNLMFATGMLSSIIITTGAAVFSRYEGWSYFDSFYYCFVTLTTIGFGDYVALQNDQALTS
KPG
(40 a.a.)

- SilkBase 1999-2023 -