SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG1168_complete:A_BomoMSG_c5473_g1_i1
Scaffold_idBomo_Chr24
NCBI non-redundant
(nr)		actin-depolymerizing_factor_1_[Bombyx_mori]
Ontology
GO:0000281 P mitotic cytokinesis
GO:0000902 P cell morphogenesis
GO:0000915 P actomyosin contractile ring assembly
GO:0001736 P establishment of planar polarity
GO:0001737 P establishment of imaginal disc-derived wing hair orientation
GO:0001745 P compound eye morphogenesis
GO:0003779 F actin binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005875 C microtubule associated complex
GO:0007015 P actin filament organization
GO:0007298 P border follicle cell migration
GO:0007409 P axonogenesis
GO:0008585 P female gonad development
GO:0010591 P regulation of lamellipodium assembly
GO:0015629 C actin cytoskeleton
GO:0016319 P mushroom body development
GO:0016363 C nuclear matrix
GO:0030041 P actin filament polymerization
GO:0030042 P actin filament depolymerization
GO:0036011 P imaginal disc-derived leg segmentation
GO:0042052 P rhabdomere development
GO:0042067 P establishment of ommatidial planar polarity
GO:0048749 P compound eye development
RNA-seq EntryA_BomoMSG_c5473_g1_i1
Sequence
(Amino Acid)
MASGVTVSDACKTTYEEIKKDKKHRYVVFYIRDEKQIDVETVGERNAEYEQFLEDLQKGG
TGECRYGLFDFEYTHQCQGTSEASKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVG
VQKYIQATDLSEASQEAVEEKLRATDRQ
*(48 a.a.)

- SilkBase 1999-2023 -