SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG11686_5prime_partial:A_BomoMSG_c23400_g1_i2
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)
putative_mediator_of_RNA_polymerase_II_transcription_subunit_26_isoform_X9_[Bombyx_mori]
Ontology
GO:0001709 P cell fate determination
GO:0001751 P compound eye photoreceptor cell differentiation
GO:0002052 P positive regulation of neuroblast proliferation
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007275 P multicellular organism development
GO:0007297 P ovarian follicle cell migration
GO:0007304 P chorion-containing eggshell formation
GO:0007422 P peripheral nervous system development
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0008101 P BMP signaling pathway
GO:0008284 P positive regulation of cell population proliferation
GO:0008340 P determination of adult lifespan
GO:0009996 P negative regulation of cell fate specification
GO:0016319 P mushroom body development
GO:0030154 P cell differentiation
GO:0030307 P positive regulation of cell growth
GO:0030707 P ovarian follicle cell development
GO:0035071 P salivary gland cell autophagic cell death
GO:0035282 P segmentation
GO:0042246 P tissue regeneration
GO:0042803 F protein homodimerization activity
GO:0043066 P negative regulation of apoptotic process
GO:0045746 P negative regulation of Notch signaling pathway
GO:0046843 P dorsal appendage formation
GO:0048102 P autophagic cell death
GO:0048477 P oogenesis
GO:0048749 P compound eye development
RNA-seq EntryA_BomoMSG_c23400_g1_i2
Sequence
(Amino Acid)
LPISGPVPVCRNASVRLLACQLVHIFFLHNYIIIKHAQYCYGHKTIKTAPLNPITGTRKS
RTVKPVEEVGTMQTKLMNGSYTSIMNKQDLLREVVVKYIDYFYPLASGTSAVAIDNKIEQ
AMDLVKSHLMFAVREEVEVLKERIAELMERITQLEVENTYLRAHASQDTLAQLPAAQGNK
PAAQPQPPVS
*(62 a.a.)

- SilkBase 1999-2023 -