SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG11609_5prime_partial:A_BomoMSG_c23359_g1_i1
Scaffold_idBomo_Chr3
NCBI non-redundant
(nr)
nucleosomal_histone_kinase_1_[Bombyx_mori]
Ontology
GO:0000070 P mitotic sister chromatid segregation
GO:0000166 F nucleotide binding
GO:0000785 C chromatin
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0006468 P protein phosphorylation
GO:0007049 P cell cycle
GO:0007052 P mitotic spindle organization
GO:0007067 P mitotic cell cycle
GO:0007126 P meiotic cell cycle
GO:0007130 P synaptonemal complex assembly
GO:0007143 P female meiotic nuclear division
GO:0008360 P regulation of cell shape
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016568 P chromatin organization
GO:0016572 P histone phosphorylation
GO:0016740 F transferase activity
GO:0018105 P peptidyl-serine phosphorylation
GO:0018107 P peptidyl-threonine phosphorylation
GO:0022008 P neurogenesis
GO:0030717 P oocyte karyosome formation
GO:0035184 F histone threonine kinase activity
GO:0035405 P histone-threonine phosphorylation
GO:0036098 P male germ-line stem cell population maintenance
GO:0036099 P female germ-line stem cell population maintenance
GO:0051301 P cell division
GO:0051321 P meiotic cell cycle
GO:0097150 P neuronal stem cell population maintenance
GO:2001020 P regulation of response to DNA damage stimulus
RNA-seq EntryA_BomoMSG_c23359_g1_i1
Sequence
(Amino Acid)
PWEKSLKEPRTVQTLKEAFMKNVKANITKQYHDVPDALIKFFEYINTLEPKQIPDYAKCR
QLFETYLKKEGKTKTSKLEFTPKKKPKTRTQDSEDDSLKENKVTKRRGKLTKVTTDTVAD
GPEKITNIRQTKRKSTEPALVVKVKKTRLAPKATPPTKKNHANIATQTSVEKAKGRQVSF
DSPISEVIGEKSSVNSSGDIFDDSFVIEERKVKRPRKVVTDEHVTIKKVVRKRVVKKGRS
WKDAPTVVNGRSPPT
*(84 a.a.)

- SilkBase 1999-2023 -