SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG11493_3prime_partial:A_BomoMSG_c23313_g1_i1
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)		serine/threonine-protein_kinase_tricorner_isoform_X2_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005938 C cell cortex
GO:0006468 P protein phosphorylation
GO:0007165 P signal transduction
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018105 P peptidyl-serine phosphorylation
GO:0022416 P chaeta development
GO:0030424 C axon
GO:0030425 C dendrite
GO:0035317 P imaginal disc-derived wing hair organization
GO:0035556 P intracellular signal transduction
GO:0040018 P positive regulation of multicellular organism growth
GO:0044297 C cell body
GO:0046872 F metal ion binding
GO:0048800 P antennal morphogenesis
GO:0048813 P dendrite morphogenesis
GO:0048814 P regulation of dendrite morphogenesis
GO:0050773 P regulation of dendrite development
GO:0070451 C cell hair
GO:0070593 P dendrite self-avoidance
GO:0071944 C cell periphery
RNA-seq EntryA_BomoMSG_c23313_g1_i1
Sequence
(Amino Acid)
MTGTDNIRFSGHTLDKATKAKVTLENFYTNLISQHYERKQRLEKLEESLKDDSLSESQKQ
EKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKA
DMLEKEQVAHVRAERDILVEADHQWVVKMYYSFQDPMN
(51 a.a.)

- SilkBase 1999-2023 -