SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG11463_5prime_partial:A_BomoMSG_c23301_g1_i1
Scaffold_idBomo_Chr9
NCBI non-redundant
(nr)		V-type_proton_ATPase_116_kDa_subunit_a_[Bombyx_mori]
Ontology
GO:0000220 C vacuolar proton-transporting V-type ATPase, V0 domain
GO:0001666 P response to hypoxia
GO:0002119 P nematode larval development
GO:0006810 P transport
GO:0006811 P ion transport
GO:0007035 P vacuolar acidification
GO:0007271 P synaptic transmission, cholinergic
GO:0009792 P embryo development ending in birth or egg hatching
GO:0015078 F proton transmembrane transporter activity
GO:0015986 P ATP synthesis coupled proton transport
GO:0015991 P proton transmembrane transport
GO:0015992 P proton transmembrane transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016471 C vacuolar proton-transporting V-type ATPase complex
GO:0033179 C proton-transporting V-type ATPase, V0 domain
GO:0040011 P locomotion
GO:0040013 P negative regulation of locomotion
GO:0043068 P positive regulation of programmed cell death
GO:0046961 F proton-transporting ATPase activity, rotational mechanism
GO:0051117 F ATPase binding
GO:0070072 P vacuolar proton-transporting V-type ATPase complex assembly
RNA-seq EntryA_BomoMSG_c23301_g1_i1
Sequence
(Amino Acid)
ALPICEIMIHQAIHTIEYVLSTISHTASYLRLWALSLAHAELSEVLWNMVLTFGLKDHNY
VGAIKLYVAFCFWALFTLAILVMMEGLSAFLHTLRLHWVEFMSKFYAGLGYIFQPFCFKT
ILEQEENKDD
*(42 a.a.)

- SilkBase 1999-2023 -