SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG11317_internal:A_BomoMSG_c23230_g1_i1
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)		low-density_lipoprotein_receptor-related_protein_6_[Bombyx_mori]
Ontology
GO:0001702 P gastrulation with mouth forming second
GO:0001944 P vasculature development
GO:0002053 P positive regulation of mesenchymal cell proliferation
GO:0002076 P osteoblast development
GO:0005515 F protein binding
GO:0005739 C mitochondrion
GO:0005783 C endoplasmic reticulum
GO:0005886 C plasma membrane
GO:0006007 P glucose catabolic process
GO:0006897 P endocytosis
GO:0007275 P multicellular organism development
GO:0008203 P cholesterol metabolic process
GO:0008217 P regulation of blood pressure
GO:0008284 P positive regulation of cell population proliferation
GO:0009952 P anterior/posterior pattern specification
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016055 P Wnt signaling pathway
GO:0017147 F Wnt-protein binding
GO:0019534 F toxin transmembrane transporter activity
GO:0033690 P positive regulation of osteoblast proliferation
GO:0035019 P somatic stem cell population maintenance
GO:0035108 P limb morphogenesis
GO:0035426 P extracellular matrix-cell signaling
GO:0042074 P cell migration involved in gastrulation
GO:0042632 P cholesterol homeostasis
GO:0042733 P embryonic digit morphogenesis
GO:0042813 F Wnt-activated receptor activity
GO:0042981 P regulation of apoptotic process
GO:0043235 C receptor complex
GO:0044332 P Wnt signaling pathway involved in dorsal/ventral axis specification
GO:0045600 P positive regulation of fat cell differentiation
GO:0045668 P negative regulation of osteoblast differentiation
GO:0045840 P positive regulation of mitotic nuclear division
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046849 P bone remodeling
GO:0046850 P regulation of bone remodeling
GO:0048539 P bone marrow development
GO:0051091 P positive regulation of DNA-binding transcription factor activity
GO:0060033 P anatomical structure regression
GO:0060042 P retina morphogenesis in camera-type eye
GO:0060070 P canonical Wnt signaling pathway
GO:0060348 P bone development
GO:0060349 P bone morphogenesis
GO:0060444 P branching involved in mammary gland duct morphogenesis
GO:0060603 P mammary gland duct morphogenesis
GO:0060612 P adipose tissue development
GO:0060764 P cell-cell signaling involved in mammary gland development
GO:0060828 P regulation of canonical Wnt signaling pathway
GO:0061178 P regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0061299 P retina vasculature morphogenesis in camera-type eye
GO:0061304 P retinal blood vessel morphogenesis
GO:0071901 P negative regulation of protein serine/threonine kinase activity
GO:0071936 F coreceptor activity involved in Wnt signaling pathway
GO:1902262 P apoptotic process involved in blood vessel morphogenesis
GO:1904886 P beta-catenin destruction complex disassembly
GO:1904928 F coreceptor activity involved in canonical Wnt signaling pathway
GO:1990851 C Wnt-Frizzled-LRP5/6 complex
GO:1990909 C Wnt signalosome
RNA-seq EntryA_BomoMSG_c23230_g1_i1
Sequence
(Amino Acid)
VIDFNGEKRKRVVKGGLVYPFALTFSNDKLYWTDWQNWSIYTWDIAANGPKIKELIKSHP
VPADIKVYDESRQIISAEDYPCKKNNAGCSHLCLLSPDPPGYNCACPTGVKLRENSSTTC
YDSPQMLLVVAQRSTISKISLDSPDFTPYTLPLKDLKRTLTVDFDPKTEYIYWADGLAKT
ISKARLDGSDQSVVVRSSGVPDSIAIDPLSRKIYWTDPVMDTINVARLDGSYEKVIIHTE
LYDPRAIALHLTAGWMFWSDWNEKKPKIERANLDGSGRVLLISEKLTWPNSIALDTVNNK
LYWGDARTHKIEVCNMDGTDRK
(106 a.a.)

- SilkBase 1999-2023 -