SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG11202_3prime_partial:A_BomoMSG_c23165_g1_i1
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)		cationic_amino_acid_transporter_3_[Bombyx_mori]
Ontology
GO:0000064 F L-ornithine transmembrane transporter activity
GO:0002537 P nitric oxide production involved in inflammatory response
GO:0003333 P amino acid transmembrane transport
GO:0005289 F high-affinity L-arginine transmembrane transporter activity
GO:0005292 F high-affinity lysine transmembrane transporter activity
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006520 P cellular amino acid metabolic process
GO:0006809 P nitric oxide biosynthetic process
GO:0006810 P transport
GO:0006865 P amino acid transport
GO:0015171 F amino acid transmembrane transporter activity
GO:0015174 F basic amino acid transmembrane transporter activity
GO:0015179 F L-amino acid transmembrane transporter activity
GO:0015181 F L-arginine transmembrane transporter activity
GO:0015189 F L-lysine transmembrane transporter activity
GO:0015297 F antiporter activity
GO:0015809 P L-arginine transmembrane transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0042116 P macrophage activation
GO:0043030 P regulation of macrophage activation
GO:0050727 P regulation of inflammatory response
GO:0061459 F L-arginine transmembrane transporter activity
GO:0097626 F low-affinity L-arginine transmembrane transporter activity
GO:0097627 F high-affinity L-ornithine transmembrane transporter activity
GO:0097638 P L-arginine import across plasma membrane
GO:0097639 P L-lysine import across plasma membrane
GO:0097640 P L-ornithine import across plasma membrane
GO:1902023 P L-arginine transmembrane transport
GO:1903352 P L-ornithine transmembrane transport
GO:1990822 P basic amino acid transmembrane transport
RNA-seq EntryA_BomoMSG_c23165_g1_i1
Sequence
(Amino Acid)
MGCGKIFATLRRCKKIDYDDDTTQLSRCLGLFDLTSLGVGSTLGLGVYVLAGAVAKTVAG
PAVAISFLVAAISSVFAGLCYAEFASRVPKAGSGYNYSYVSVGEFIAFTIGWNLILEYAI
GTASVAKGMAVYIDTLFNNTMAKTLTAATPINVSFLADYPDFFAFGLVILITLLLGIGVS
ESTKLNNVFTALNMTTVIIVVVAGAIKSNPANWNIKLADIPPEYVSQAGEGGFMPWGVAG
VMAGD
(80 a.a.)

- SilkBase 1999-2023 -