SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG11181_internal:A_BomoMSG_c23147_g1_i3
Scaffold_idBomo_Chr6
NCBI non-redundant
(nr)
tyrosine-protein_kinase_Fer_isoform_X5_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004715 F non-membrane spanning protein tyrosine kinase activity
GO:0005102 F signaling receptor binding
GO:0005524 F ATP binding
GO:0005543 F phospholipid binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005912 C adherens junction
GO:0006468 P protein phosphorylation
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007275 P multicellular organism development
GO:0007391 P dorsal closure
GO:0007394 P dorsal closure, elongation of leading edge cells
GO:0007411 P axon guidance
GO:0008594 P photoreceptor cell morphogenesis
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0019898 C extrinsic component of membrane
GO:0031234 C extrinsic component of cytoplasmic side of plasma membrane
GO:0038083 P peptidyl-tyrosine autophosphorylation
GO:0042127 P regulation of cell population proliferation
GO:0045087 P innate immune response
GO:0046664 P dorsal closure, amnioserosa morphology change
GO:0051017 P actin filament bundle assembly
RNA-seq EntryA_BomoMSG_c23147_g1_i3
Sequence
(Amino Acid)
DRKSVMELVSGGSLLTYLRTRAAALSSRTLMAMCRDAAGGMRYLESKNCIHRDLAARNCL
VGDDNIVKISDFGMSREEEEYIVSGGMKQIPIKWTAPEALNFGKYTSLCDVWSYGVLMWE
IFAKGDTPYAGMSNSRRSEER
(46 a.a.)

- SilkBase 1999-2023 -