SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG1116_internal:A_BomoMSG_c5251_g1_i1
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)		kinesin-like_protein_7_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000278 P mitotic cell cycle
GO:0000775 C chromosome, centromeric region
GO:0000776 C kinetochore
GO:0000777 C kinetochore
GO:0000778 C kinetochore
GO:0000779 C condensed chromosome, centromeric region
GO:0000940 C outer kinetochore
GO:0003777 F microtubule motor activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005819 C spindle
GO:0005856 C cytoskeleton
GO:0005871 C kinesin complex
GO:0005874 C microtubule
GO:0007018 P microtubule-based movement
GO:0007049 P cell cycle
GO:0007059 P chromosome segregation
GO:0007067 P mitotic cell cycle
GO:0007080 P mitotic metaphase plate congression
GO:0007088 P regulation of mitotic nuclear division
GO:0007094 P mitotic spindle assembly checkpoint signaling
GO:0007275 P multicellular organism development
GO:0008017 F microtubule binding
GO:0008152 P metabolic process
GO:0008608 P attachment of spindle microtubules to kinetochore
GO:0015630 C microtubule cytoskeleton
GO:0016020 C membrane
GO:0016887 F ATP hydrolysis activity
GO:0019901 F protein kinase binding
GO:0030071 P regulation of mitotic metaphase/anaphase transition
GO:0030496 C midbody
GO:0043515 F kinetochore binding
GO:0045184 P establishment of protein localization
GO:0045842 P positive regulation of mitotic metaphase/anaphase transition
GO:0045860 P positive regulation of protein kinase activity
GO:0050793 P regulation of developmental process
GO:0051301 P cell division
GO:0051315 P attachment of mitotic spindle microtubules to kinetochore
GO:0051984 P positive regulation of chromosome segregation
GO:0051987 P positive regulation of attachment of spindle microtubules to kinetochore
GO:1990023 C mitotic spindle midzone
RNA-seq EntryA_BomoMSG_c5251_g1_i1
Sequence
(Amino Acid)
ANRQTGSTNMNEKSSRSHSIFQITIESKEHVEGKEEVGSVNVSQLNLVDLAGSERAGQTG
AKGLRFKEGTHINKSLSALALVIKKLAENPGQFNNYRDSKLTRILQNSLGGNAKTSIICA
VTPAALEETISTLQFGNRAKFIKNEPILNEVQSNATMIQQLTKKLG
(54 a.a.)

- SilkBase 1999-2023 -