SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG11146_complete:A_BomoMSG_c23127_g1_i7
Scaffold_idBomo_Chr7
NCBI non-redundant
(nr)
splicing_factor_arginine/serine-rich_6_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000381 P regulation of alternative mRNA splicing, via spliceosome
GO:0000398 P mRNA splicing, via spliceosome
GO:0001178 P regulation of transcriptional start site selection at RNA polymerase II promoter
GO:0003676 F nucleic acid binding
GO:0003723 F RNA binding
GO:0003729 F mRNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005700 C polytene chromosome
GO:0006376 P mRNA splice site selection
GO:0006397 P mRNA processing
GO:0007067 P mitotic cell cycle
GO:0008380 P RNA splicing
GO:0010468 P regulation of gene expression
GO:0016607 C nuclear speck
GO:0031440 P regulation of mRNA 3'-end processing
GO:0035062 C omega speckle
GO:0035327 C euchromatin
GO:0048024 P regulation of mRNA splicing, via spliceosome
GO:0071011 C precatalytic spliceosome
GO:0071013 C catalytic step 2 spliceosome
RNA-seq EntryA_BomoMSG_c23127_g1_i7
Sequence
(Amino Acid)
MVGSRVYVGGLPFGVRERDLEKFFKGFGRIRDILIKNGYGFVEFEDYRDADDAVYELNGK
ELLGERVVVEPARGIDRSADRYRRGDRHYERSGGGRSRYE
*(32 a.a.)

- SilkBase 1999-2023 -