SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG1112_internal:A_BomoMSG_c5233_g1_i1
Scaffold_idBomo_Chr20
NCBI non-redundant
(nr)		microtubule-actin_cross-linking_factor_1,_isoforms_1/2/3/5_[Bombyx_mori]
Ontology
GO:0001725 C stress fiber
GO:0003779 F actin binding
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005635 C nuclear envelope
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0005882 C intermediate filament
GO:0005886 C plasma membrane
GO:0005925 C focal adhesion
GO:0005938 C cell cortex
GO:0007010 P cytoskeleton organization
GO:0007050 P regulation of cell cycle
GO:0007155 P cell adhesion
GO:0007409 P axonogenesis
GO:0008090 P retrograde axonal transport
GO:0008092 F cytoskeletal protein binding
GO:0009898 C cytoplasmic side of plasma membrane
GO:0014704 C intercalated disc
GO:0015629 C actin cytoskeleton
GO:0015630 C microtubule cytoskeleton
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016023 C cytoplasmic vesicle
GO:0030018 C Z disc
GO:0030054 C cell junction
GO:0030056 C hemidesmosome
GO:0030424 C axon
GO:0031673 C H zone
GO:0035371 C microtubule plus-end
GO:0042383 C sarcolemma
GO:0042803 F protein homodimerization activity
GO:0042995 C cell projection
GO:0045104 P intermediate filament cytoskeleton organization
GO:0046872 F metal ion binding
GO:0046907 P intracellular transport
GO:0048471 C perinuclear region of cytoplasm
GO:0051010 F microtubule plus-end binding
GO:0097038 C perinuclear endoplasmic reticulum
GO:0097481 C postsynaptic density
GO:1904115 C axon cytoplasm
RNA-seq EntryA_BomoMSG_c5233_g1_i1
Sequence
(Amino Acid)
RAQRFLDEVEPQVRGVLSEPVGGEPRAVEAQLSRAKHLHNEILAQGRLIDNAKDACDQLV
KSLEGHLTPAEIRQLEVPVVDLTSRYHDLSEAVGSRCSELEAALLQCQGLQDSVEAQAHW
LGEAEDLFKQQLGGASLVVARLEEQVREQRRAHAQL
(51 a.a.)

- SilkBase 1999-2023 -