SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG1108_internal:A_BomoMSG_c5215_g1_i1
Scaffold_idBomo_Chr22
NCBI non-redundant
(nr)		bifunctional_heparan_sulfate_N-deacetylase/N-sulfotransferase_[Bombyx_mori]
Ontology
GO:0000137 C Golgi cis cisterna
GO:0000139 C Golgi membrane
GO:0003824 F catalytic activity
GO:0005622 C intracellular anatomical structure
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0006024 P glycosaminoglycan biosynthetic process
GO:0006790 P sulfur compound metabolic process
GO:0007166 P cell surface receptor signaling pathway
GO:0007283 P spermatogenesis
GO:0007367 P segment polarity determination
GO:0007427 P epithelial cell migration, open tracheal system
GO:0007428 P primary branching, open tracheal system
GO:0007474 P imaginal disc-derived wing vein specification
GO:0007507 P heart development
GO:0007509 P mesoderm migration involved in gastrulation
GO:0008146 F sulfotransferase activity
GO:0008152 P metabolic process
GO:0008543 P fibroblast growth factor receptor signaling pathway
GO:0008587 P imaginal disc-derived wing margin morphogenesis
GO:0015012 P heparan sulfate proteoglycan biosynthetic process
GO:0015014 P heparan sulfate proteoglycan biosynthetic process, polysaccharide chain biosynthetic process
GO:0015016 F [heparan sulfate]-glucosamine N-sulfotransferase activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016055 P Wnt signaling pathway
GO:0016740 F transferase activity
GO:0016787 F hydrolase activity
GO:0030210 P heparin biosynthetic process
GO:0045570 P regulation of imaginal disc growth
GO:0048312 P intracellular distribution of mitochondria
GO:0048488 P synaptic vesicle endocytosis
GO:0060828 P regulation of canonical Wnt signaling pathway
GO:0090097 P regulation of BMP signaling pathway
RNA-seq EntryA_BomoMSG_c5215_g1_i1
Sequence
(Amino Acid)
VFMTHMSNYGNDRLALYTFESVVKFLRCWTNVRLASAPPLALAEKYFQLRPDELNPLWGN
PCDDIRHRRIWSKSKWCGTLPRLLVIGPQKTGSTALYTFLAMHPTLKPNLPSP
(36 a.a.)

- SilkBase 1999-2023 -