SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG11063_internal:A_BomoMSG_c23082_g2_i3
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)		protein_inturned_[Bombyx_mori]
Ontology
GO:0003674 F molecular_function
GO:0005737 C cytoplasm
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0008589 P regulation of smoothened signaling pathway
GO:0009986 C cell surface
GO:0010839 P negative regulation of keratinocyte proliferation
GO:0021513 P spinal cord dorsal/ventral patterning
GO:0021915 P neural tube development
GO:0030030 P cell projection organization
GO:0030216 P keratinocyte differentiation
GO:0030278 P regulation of ossification
GO:0031069 P hair follicle morphogenesis
GO:0042384 P cilium assembly
GO:0042733 P embryonic digit morphogenesis
GO:0045880 P positive regulation of smoothened signaling pathway
GO:0051782 P negative regulation of cell division
GO:0060173 P limb development
GO:0060271 P cilium assembly
GO:1903887 P motile cilium assembly
RNA-seq EntryA_BomoMSG_c23082_g2_i3
Sequence
(Amino Acid)
DRKSVTDIRKSLLNEINRVTVHRITTGEENVLFHFIQLEAEKGMFIAPVRNIEEQANNVL
YSFIIRTFRSACKKYTNYFSKVLGMKDVLVEGFPNLFCVLPTLRIN
(34 a.a.)

- SilkBase 1999-2023 -