SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG1104_internal:A_BomoMSG_c5199_g1_i1
Scaffold_idBomo_Chr20
NCBI non-redundant
(nr)		LOW_QUALITY_PROTEIN:_ras-responsive_element-binding_protein_1_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000979 F RNA polymerase II core promoter sequence-specific DNA binding
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007165 P signal transduction
GO:0007275 P multicellular organism development
GO:0010634 P positive regulation of epithelial cell migration
GO:0016607 C nuclear speck
GO:0033601 P positive regulation of mammary gland epithelial cell proliferation
GO:0043565 F sequence-specific DNA binding
GO:0044212 F transcription cis-regulatory region binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0070062 C extracellular exosome
GO:1900026 P positive regulation of substrate adhesion-dependent cell spreading
GO:1903691 P positive regulation of wound healing, spreading of epidermal cells
GO:2000394 P positive regulation of lamellipodium morphogenesis
RNA-seq EntryA_BomoMSG_c5199_g1_i1
Sequence
(Amino Acid)
GIRHIGAARDLADIQSILNVTSAGSLLERLTGNRVALESTVLTPPDTVVKERETEETQDN
FAAEFRRMKLRGEFPCRLCPAKFPNLRALKGHNRVHLSGTGPGPYQCNMCPHASLDKAAL
VRHMRTHNGDRPYECAVCNYAFTTKANCERHLRNRHA
(51 a.a.)

- SilkBase 1999-2023 -