SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG11039_internal:A_BomoMSG_c23071_g1_i1
Scaffold_idBomo_Chr16
NCBI non-redundant
(nr)		titin_isoform_X1_[Bombyx_mori]
Ontology
GO:0000118 C histone deacetylase complex
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000790 C chromatin
GO:0001012 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001102 F RNA polymerase II-specific DNA-binding transcription factor binding
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003714 F transcription corepressor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005876 C spindle microtubule
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0007519 P skeletal muscle tissue development
GO:0007595 P lactation
GO:0007623 P circadian rhythm
GO:0008284 P positive regulation of cell population proliferation
GO:0010629 P negative regulation of gene expression
GO:0016020 C membrane
GO:0016568 P chromatin organization
GO:0016580 C Sin3 complex
GO:0016922 F nuclear receptor binding
GO:0017053 C transcription repressor complex
GO:0019904 F protein domain specific binding
GO:0021549 P cerebellum development
GO:0030331 F estrogen receptor binding
GO:0035257 F nuclear receptor binding
GO:0042826 F histone deacetylase binding
GO:0042974 F retinoic acid receptor binding
GO:0042975 F peroxisome proliferator activated receptor binding
GO:0044212 F transcription cis-regulatory region binding
GO:0044255 P cellular lipid metabolic process
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046329 P negative regulation of JNK cascade
GO:0046965 F retinoid X receptor binding
GO:0046966 F thyroid hormone receptor binding
GO:0048471 C perinuclear region of cytoplasm
GO:0051225 P spindle assembly
GO:0072362 P obsolete regulation of glycolytic process by negative regulation of transcription from RNA polymerase II promoter
GO:0072368 P obsolete regulation of lipid transport by negative regulation of transcription from RNA polymerase II promoter
GO:1903799 P negative regulation of production of miRNAs involved in gene silencing by miRNA
GO:2000191 P regulation of fatty acid transport
RNA-seq EntryA_BomoMSG_c23071_g1_i1
Sequence
(Amino Acid)
ALPIWRIKAESEKREDVLADEYTKRAAEWARRVERIEQSQKRKAKDAKNREFFEKVFPEL
RKQREERERFHRLGARVKSEAELEELADGLHEQEHEDKKMR
(32 a.a.)

- SilkBase 1999-2023 -