SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG11010_3prime_partial:A_BomoMSG_c23038_g1_i2
Scaffold_idBomo_Chr7
NCBI non-redundant
(nr)		probable_DNA_mismatch_repair_protein_Msh6_isoform_X1_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000228 C nuclear chromosome
GO:0000400 F four-way junction DNA binding
GO:0000710 P meiotic mismatch repair
GO:0003677 F DNA binding
GO:0003684 F damaged DNA binding
GO:0005524 F ATP binding
GO:0006281 P DNA repair
GO:0006298 P mismatch repair
GO:0006301 P postreplication repair
GO:0006974 P cellular response to DNA damage stimulus
GO:0007131 P reciprocal meiotic recombination
GO:0008630 P intrinsic apoptotic signaling pathway in response to DNA damage
GO:0009411 P response to UV
GO:0030983 F mismatched DNA binding
GO:0032137 F guanine/thymine mispair binding
GO:0032138 F single base insertion or deletion binding
GO:0032301 C MutSalpha complex
GO:0043570 P maintenance of DNA repeat elements
GO:0045910 P negative regulation of DNA recombination
RNA-seq EntryA_BomoMSG_c23038_g1_i2
Sequence
(Amino Acid)
MESARKGFKRFSTSETKEFLSCMMAAEEQKTNVLKDLSRRMYEKFSSHYAQWEAAVHCLA
SLDVLLAFAEFARQQHGDICLPDVTFDTGTKVKGYAIQYIYID
(33 a.a.)

- SilkBase 1999-2023 -