| Name | O_BomoMSG10985_internal:A_BomoMSG_c23030_g1_i1 |
| Scaffold_id | Bomo_Chr15 |
NCBI non-redundant
(nr) | probable_phospholipid-transporting_ATPase_IIB_[Bombyx_mori] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0000287 |
F |
magnesium ion binding |
| GO:0004012 |
F |
ATPase-coupled intramembrane lipid transporter activity |
| GO:0005524 |
F |
ATP binding |
| GO:0005768 |
C |
endosome |
| GO:0005769 |
C |
early endosome |
| GO:0005794 |
C |
Golgi apparatus |
| GO:0005802 |
C |
trans-Golgi network |
| GO:0005886 |
C |
plasma membrane |
| GO:0006890 |
P |
retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum |
| GO:0006897 |
P |
endocytosis |
| GO:0008152 |
P |
metabolic process |
| GO:0015914 |
P |
phospholipid transport |
| GO:0016020 |
C |
membrane |
| GO:0016021 |
C |
integral component of membrane |
| GO:0016787 |
F |
hydrolase activity |
| GO:0031901 |
C |
early endosome membrane |
| GO:0045332 |
P |
phospholipid translocation |
| GO:0046872 |
F |
metal ion binding |
| GO:0048471 |
C |
perinuclear region of cytoplasm |
| GO:0055037 |
C |
recycling endosome |
|
| RNA-seq Entry | A_BomoMSG_c23030_g1_i1 |
Sequence
(Amino Acid) | LQLGGGAEWRVARDCSSRLHAHTLLLALADQPNMDLIIEGETLEVCLQSYEEEFVKLLCG
CSGVVVARCSPTQKATVARLLRARGHVVAAVGDGGNDVAMIQEADIGVGIEGA
(36 a.a.) |
