SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG10970_3prime_partial:A_BomoMSG_c23017_g1_i1
Scaffold_idBomo_Chr19
NCBI non-redundant
(nr)		pro-epidermal_growth_factor_[Bombyx_mori]
Ontology
GO:0000086 P G2/M transition of mitotic cell cycle
GO:0000139 C Golgi membrane
GO:0003015 P heart process
GO:0005154 F epidermal growth factor receptor binding
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0005886 C plasma membrane
GO:0007173 P epidermal growth factor receptor signaling pathway
GO:0007275 P multicellular organism development
GO:0007298 P border follicle cell migration
GO:0007399 P nervous system development
GO:0007421 P stomatogastric nervous system development
GO:0007422 P peripheral nervous system development
GO:0007424 P open tracheal system development
GO:0007432 P salivary gland boundary specification
GO:0007438 P oenocyte development
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0008284 P positive regulation of cell population proliferation
GO:0008317 F gurken receptor binding
GO:0008355 P olfactory learning
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016330 P second mitotic wave involved in compound eye morphogenesis
GO:0022008 P neurogenesis
GO:0030154 P cell differentiation
GO:0035225 P determination of genital disc primordium
GO:0035277 P spiracle morphogenesis, open tracheal system
GO:0043066 P negative regulation of apoptotic process
GO:0045470 P R8 cell-mediated photoreceptor organization
GO:0045742 P positive regulation of epidermal growth factor receptor signaling pathway
GO:0046673 P negative regulation of compound eye retinal cell programmed cell death
GO:0046845 P branched duct epithelial cell fate determination, open tracheal system
GO:0048149 P behavioral response to ethanol
GO:0048865 P stem cell fate commitment
GO:0050769 P positive regulation of neurogenesis
GO:0061331 P epithelial cell proliferation involved in Malpighian tubule morphogenesis
RNA-seq EntryA_BomoMSG_c23017_g1_i1
Sequence
(Amino Acid)
MRAKDSCSKFECGHVIAFRISHKSPSNVKIVHVPRAPTLRIVRKMQSLVVWWAVVSAAWA
LAGACSSSISKRPARPARPQRPQPQPQPQPRINVTFPTFKCEPEYSQYYCLNGGVCFTVV
ISESPIYNCECQSGYVGPRCEFKDLDNSYVLSGRQLMMETASIAGGATVAVFLAILVCLG
AWVRLQRRDKSPAAAERGQVTLG
(66 a.a.)

- SilkBase 1999-2023 -