SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG10869_3prime_partial:A_BomoMSG_c22967_g1_i1
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)
E3_ubiquitin-protein_ligase_SIAH1-like_[Bombyx_mori]
Ontology
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005769 C early endosome
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0006915 P apoptotic process
GO:0007049 P cell cycle
GO:0007275 P multicellular organism development
GO:0007283 P spermatogenesis
GO:0008022 F protein C-terminus binding
GO:0008270 F zinc ion binding
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0030154 P cell differentiation
GO:0030163 P protein catabolic process
GO:0030877 C beta-catenin destruction complex
GO:0031648 P protein destabilization
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0042802 F identical protein binding
GO:0043065 P positive regulation of apoptotic process
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0046872 F metal ion binding
GO:0051402 P neuron apoptotic process
GO:0061630 F ubiquitin protein ligase activity
GO:2001244 P positive regulation of intrinsic apoptotic signaling pathway
RNA-seq EntryA_BomoMSG_c22967_g1_i1
Sequence
(Amino Acid)
MSTNIKRRGASGSSCSVPGVPALVNAPTAMSADLASLFECPVCFDYVLPPILQCQSGHLV
CSSCRPKLSCCPTCRGPLGNIRNLAMEKVASNVMFPCKHSNTGCTVTLVHTEKAEHEEAC
EFRPYSCPCPGRSEER
(44 a.a.)

- SilkBase 1999-2023 -