SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG10856_3prime_partial:A_BomoMSG_c22962_g1_i1
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)		E3_ubiquitin-protein_ligase_RNF180-like_[Bombyx_mori]
Ontology
GO:0000209 P protein polyubiquitination
GO:0005634 C nucleus
GO:0005635 C nuclear envelope
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0008270 F zinc ion binding
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0030534 P adult behavior
GO:0031227 C intrinsic component of endoplasmic reticulum membrane
GO:0031398 P positive regulation of protein ubiquitination
GO:0031624 F ubiquitin conjugating enzyme binding
GO:0032436 P positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0042415 P norepinephrine metabolic process
GO:0042428 P serotonin metabolic process
GO:0046872 F metal ion binding
GO:0050790 P regulation of catalytic activity
GO:0061630 F ubiquitin protein ligase activity
GO:1901360 P organic cyclic compound metabolic process
RNA-seq EntryA_BomoMSG_c22962_g1_i1
Sequence
(Amino Acid)
MISCKSNAIKCLKCRTKLIDDISLITNQNFQCDPQKCNSYDIKKVIYLMEDKLPEWIKSR
IEKEQWTKGRLNCEKCSCRIGSFDYISGRKCECGETVLPPVHFTSS
(34 a.a.)

- SilkBase 1999-2023 -