SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG10850_complete:A_BomoMSG_c22957_g1_i2
Scaffold_idBomo_Chr25
NCBI non-redundant
(nr)
Rad51_homolog_[Bombyx_mori]
Ontology
GO:0000150 F DNA strand exchange activity
GO:0000166 F nucleotide binding
GO:0000228 C nuclear chromosome
GO:0000400 F four-way junction DNA binding
GO:0000722 P telomere maintenance via recombination
GO:0000724 P double-strand break repair via homologous recombination
GO:0000730 P DNA recombinase assembly
GO:0000784 C chromosome, telomeric region
GO:0000785 C chromatin
GO:0000793 C condensed chromosome
GO:0000794 C condensed nuclear chromosome
GO:0000800 C lateral element
GO:0001932 P regulation of protein phosphorylation
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003690 F double-stranded DNA binding
GO:0003697 F single-stranded DNA binding
GO:0004520 F endodeoxyribonuclease activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0006259 P DNA metabolic process
GO:0006268 P DNA unwinding involved in DNA replication
GO:0006281 P DNA repair
GO:0006312 P mitotic recombination
GO:0006974 P cellular response to DNA damage stimulus
GO:0007126 P meiotic cell cycle
GO:0007131 P reciprocal meiotic recombination
GO:0008022 F protein C-terminus binding
GO:0008094 F ATP-dependent activity, acting on DNA
GO:0010212 P response to ionizing radiation
GO:0010569 P regulation of double-strand break repair via homologous recombination
GO:0010833 P telomere maintenance via telomere lengthening
GO:0016605 C PML body
GO:0031297 P replication fork processing
GO:0032200 P telomere organization
GO:0035861 C site of double-strand break
GO:0042148 P strand invasion
GO:0042802 F identical protein binding
GO:0043142 F single-stranded DNA helicase activity
GO:0048471 C perinuclear region of cytoplasm
GO:0051106 P positive regulation of DNA ligation
GO:0051260 P protein homooligomerization
GO:0070182 F DNA polymerase binding
GO:0070192 P chromosome organization involved in meiotic cell cycle
GO:0071312 P cellular response to alkaloid
GO:0071479 P cellular response to ionizing radiation
GO:0072711 P cellular response to hydroxyurea
GO:0072757 P cellular response to camptothecin
GO:1990414 P replication-born double-strand break repair via sister chromatid exchange
GO:1990426 P mitotic recombination-dependent replication fork processing
RNA-seq EntryA_BomoMSG_c22957_g1_i2
Sequence
(Amino Acid)
MNTTASATTTSLDEDADECGPQLISKLEGNGITSGDIKKLEEAGYHTVESVAYAPKKWLI
TIKGISEAKADKILAEASKLVPMGFTTATEFHQKRAEIIQLTTGSKELDRLLGGGIETGS
ITEIFGEFRTGKTQLCHTLAVTCQLPIEQSGGEGKCMYIDTEGTFRPERLLAVAQRYGME
GAAVLDNVAYARAYNTDHQTQLLVQACAMMAESRYSLIIVDSATALYRTDYSGRGELNSR
QLHLGRFMRMLLRLADEFGVAVIITNQVVAQVDAVGVFNADTKKPIGGHIIAHASTTRLY
LRKGRGDNRVCKIYDSPCLPETEAMFAISAEGITDAKE
*(112 a.a.)

- SilkBase 1999-2023 -