SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG10768_internal:A_BomoMSG_c22902_g1_i1
Scaffold_idBomo_Chr12
NCBI non-redundant
(nr)		menin_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000165 P MAPK cascade
GO:0000400 F four-way junction DNA binding
GO:0000403 F Y-form DNA binding
GO:0000784 C chromosome, telomeric region
GO:0000785 C chromatin
GO:0000790 C chromatin
GO:0001503 P ossification
GO:0001776 P leukocyte homeostasis
GO:0001933 P negative regulation of protein phosphorylation
GO:0002051 P osteoblast fate commitment
GO:0002076 P osteoblast development
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003690 F double-stranded DNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006338 P chromatin remodeling
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006974 P cellular response to DNA damage stimulus
GO:0007050 P regulation of cell cycle
GO:0008285 P negative regulation of cell population proliferation
GO:0009411 P response to UV
GO:0010332 P response to gamma radiation
GO:0010468 P regulation of gene expression
GO:0010628 P positive regulation of gene expression
GO:0016363 C nuclear matrix
GO:0016568 P chromatin organization
GO:0016571 P histone methylation
GO:0018024 F histone-lysine N-methyltransferase activity
GO:0030097 P hemopoiesis
GO:0030511 P positive regulation of transforming growth factor beta receptor signaling pathway
GO:0030674 F protein-macromolecule adaptor activity
GO:0031062 P positive regulation of histone methylation
GO:0032092 P positive regulation of protein binding
GO:0032154 C cleavage furrow
GO:0034968 P histone lysine methylation
GO:0035097 C histone methyltransferase complex
GO:0043065 P positive regulation of apoptotic process
GO:0043234 C protein-containing complex
GO:0043280 P positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043433 P negative regulation of DNA-binding transcription factor activity
GO:0043565 F sequence-specific DNA binding
GO:0044212 F transcription cis-regulatory region binding
GO:0045597 P positive regulation of cell differentiation
GO:0045668 P negative regulation of osteoblast differentiation
GO:0045669 P positive regulation of osteoblast differentiation
GO:0045736 P negative regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0045786 P negative regulation of cell cycle
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046329 P negative regulation of JNK cascade
GO:0046621 P negative regulation of organ growth
GO:0047485 F protein N-terminus binding
GO:0048704 P embryonic skeletal system morphogenesis
GO:0051781 P positive regulation of cell division
GO:0051974 P negative regulation of telomerase activity
GO:0060021 P roof of mouth development
GO:0060135 P maternal process involved in female pregnancy
GO:0070412 F R-SMAD binding
RNA-seq EntryA_BomoMSG_c22902_g1_i1
Sequence
(Amino Acid)
VNLHSNNFVKMKFPCIEWDEVRSLHERFVNLMRTGVDAKLLSGAYATRDLVKKVADVVWN
SLTRSYYKDRAHLQSIYSFLTGNKLDCFGVAFAVTAGCQVLGKQDVHLALSEDHAWVVFG
QDGKETAEVTWHGKGNEDKRGRSVGDGVSARSWLYVAGKPVVCTRVMELAALVSSINTTL
TQTVDVHEVAQMQHKLLWLLYDSGYLDAYPMALGNLADLDDYMKVPNITKENNTTSSTDD
ISNVQMDNTQRPDVAGLYAQAIKSAKTYYDDRHVYPYTLQGGYYHRQKMYKEAFHAWASA
GDVIRHYNYSRDDEEIYKEFAEIANELIPQLMKAESSGHSARSILKDPECFASLLRFYDG
ICKWEEGSQTPILHIGWAKPLVSTISKFDAEVRAQVYIVCRPDSGEVLEHQEPDGEKKET
TENGRSEER
(142 a.a.)

- SilkBase 1999-2023 -