SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG10766_complete:A_BomoMSG_c22900_g1_i1
Scaffold_idBomo_Chr28
NCBI non-redundant
(nr)		CDK-activating_kinase_assembly_factor_MAT1_[Bombyx_mori]
Ontology
GO:0000079 P regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005675 C transcription factor TFIIH holo complex
GO:0005737 C cytoplasm
GO:0006281 P DNA repair
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006366 P transcription by RNA polymerase II
GO:0006468 P protein phosphorylation
GO:0007049 P cell cycle
GO:0007512 P adult heart development
GO:0008094 F ATP-dependent activity, acting on DNA
GO:0008270 F zinc ion binding
GO:0008353 F RNA polymerase II CTD heptapeptide repeat kinase activity
GO:0021591 P ventricular system development
GO:0043066 P negative regulation of apoptotic process
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0047485 F protein N-terminus binding
GO:0048661 P positive regulation of smooth muscle cell proliferation
GO:0051592 P response to calcium ion
RNA-seq EntryA_BomoMSG_c22900_g1_i1
Sequence
(Amino Acid)
MDDQACPRCKTTKYRNPSLKLMVNVCGHVLCENCVDLLFLKGSGSCPDCNIVLRRGNFRV
QLFEDPMVEKEVDIRKRVLRDYNKKEEDFNSLREYNDYLEEIETIVYNLTNNIDIVETNK
RI
*(40 a.a.)

- SilkBase 1999-2023 -