SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG10744_3prime_partial:A_BomoMSG_c22887_g1_i1
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)		zinc_transporter_ZIP10_[Bombyx_mori]
Ontology
GO:0002903 P negative regulation of B cell apoptotic process
GO:0005385 F zinc ion transmembrane transporter activity
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006829 P zinc ion transport
GO:0006882 P cellular zinc ion homeostasis
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030001 P metal ion transport
GO:0030890 P positive regulation of B cell proliferation
GO:0046873 F metal ion transmembrane transporter activity
GO:0050861 P positive regulation of B cell receptor signaling pathway
GO:0055085 P transmembrane transport
GO:0071578 P zinc ion import across plasma membrane
GO:1903615 P positive regulation of protein tyrosine phosphatase activity
RNA-seq EntryA_BomoMSG_c22887_g1_i1
Sequence
(Amino Acid)
MLTKCAVVVLALTLVAAAVSANSELDLNNTIPAERYFIDKIFNKYGDKGIITFEGFEHLL
ASLGLGGRVFNSPHDLALHRINGTFRPLHDTLHRHRRSPPEISSTTILQKSCLSPREILE
VYGMENEPGVITIRP
(44 a.a.)

- SilkBase 1999-2023 -