SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG10708_complete:A_BomoMSG_c22856_g1_i2
Scaffold_idBomo_Chr7
NCBI non-redundant
(nr)
zinc_finger_and_BTB_domain-containing_protein_14_isoform_X2_[Bombyx_mori]
Ontology
GO:0002118 P aggressive behavior
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0007275 P multicellular organism development
GO:0007417 P central nervous system development
GO:0007517 P muscle organ development
GO:0007530 P sex determination
GO:0007617 P mating behavior
GO:0007618 P mating
GO:0007620 P copulation
GO:0008049 P male courtship behavior
GO:0016199 P axon midline choice point recognition
GO:0016543 P male courtship behavior, orientation prior to leg tapping and wing vibration
GO:0016544 P male courtship behavior, tapping to detect pheromone
GO:0016545 P male courtship behavior, veined wing vibration
GO:0021954 P central nervous system neuron development
GO:0044719 P regulation of imaginal disc-derived wing size
GO:0045433 P male courtship behavior, veined wing generated song production
GO:0046661 P male sex differentiation
GO:0046872 F metal ion binding
GO:0048047 P mating behavior, sex discrimination
GO:0048065 P male courtship behavior, veined wing extension
GO:0048813 P dendrite morphogenesis
GO:0060179 P male mating behavior
RNA-seq EntryA_BomoMSG_c22856_g1_i2
Sequence
(Amino Acid)
MLQTGALTDVTLSASGTNVKAHRIVLASCSQYFAQLFKELEGDNTLVVVLGCEAAELKLL
LTFMYTGEVTASRLVLPSLLRLAQTLKVSGLTDADTNSTLTPTEPEPHENSSPINLEAKN
ETPTTENSFSFDTPIKDAKEGEEIAESFGSTMERDRLSKLDQIVQNLYRISSNPSAALLT
NNVPETTDYEKKWRLTSSVCGICNKKLSNQYNLRVHMETHAGRRHACRACSHVSRSRDAL
RKHVAYRHAPQNKPDM
*(84 a.a.)

- SilkBase 1999-2023 -