SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG10698_3prime_partial:A_BomoMSG_c22851_g1_i1
Scaffold_idBomo_Chr26
NCBI non-redundant
(nr)		RB-associated_KRAB_zinc_finger_protein_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001078 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001701 P in utero embryonic development
GO:0001763 P morphogenesis of a branching structure
GO:0001892 P embryonic placenta development
GO:0001893 P maternal placenta development
GO:0003170 P heart valve development
GO:0003279 P cardiac septum development
GO:0003281 P ventricular septum development
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007275 P multicellular organism development
GO:0007281 P germ cell development
GO:0008168 F methyltransferase activity
GO:0009791 P post-embryonic development
GO:0010628 P positive regulation of gene expression
GO:0010629 P negative regulation of gene expression
GO:0016740 F transferase activity
GO:0030889 P negative regulation of B cell proliferation
GO:0031665 P negative regulation of lipopolysaccharide-mediated signaling pathway
GO:0032259 P methylation
GO:0035904 P aorta development
GO:0042127 P regulation of cell population proliferation
GO:0042462 P eye photoreceptor cell development
GO:0042826 F histone deacetylase binding
GO:0043565 F sequence-specific DNA binding
GO:0045165 P cell fate commitment
GO:0045579 P positive regulation of B cell differentiation
GO:0046872 F metal ion binding
GO:0048844 P artery morphogenesis
GO:0048869 P cellular developmental process
GO:0060576 P intestinal epithelial cell development
GO:0060707 P trophoblast giant cell differentiation
GO:0060976 P coronary vasculature development
GO:1990654 P sebum secreting cell proliferation
RNA-seq EntryA_BomoMSG_c22851_g1_i1
Sequence
(Amino Acid)
MNIAHNFNEHSQTYRKIQPKLQVWENDCNDKFSGDESTSRNGDFQIEDELESSGSEREYL
EINDDTDDFLSTNVMCVINQDSEINLVSNKDNENYHIEQYQCGMCSMISETLDKLEIHCE
LNHNIKVTDTMKCDVCKEDVSVAIQHIHMKQHKDEYKRKRRKVGKIECNICKKYIMKTYI
KYHMKMHGPETERAERKKYCRLCQKPISLHYFVSHLRRVHQRGPNEEK
(75 a.a.)

- SilkBase 1999-2023 -