SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG1065_internal:A_BomoMSG_c5000_g1_i1
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)
gamma-glutamyltranspeptidase_1_isoform_X3_[Bombyx_mori]
Ontology
GO:0002682 P regulation of immune system process
GO:0003840 F obsolete gamma-glutamyltransferase activity
GO:0005615 C extracellular space
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006508 P proteolysis
GO:0006536 P glutamate metabolic process
GO:0006749 P glutathione metabolic process
GO:0006750 P glutathione biosynthetic process
GO:0006751 P glutathione catabolic process
GO:0007283 P spermatogenesis
GO:0008233 F peptidase activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016740 F transferase activity
GO:0016746 F acyltransferase activity
GO:0016787 F hydrolase activity
GO:0019344 P cysteine biosynthetic process
GO:0019370 P leukotriene biosynthetic process
GO:0031638 P zymogen activation
GO:0031988 C vesicle
GO:0036374 F glutathione hydrolase activity
GO:0050727 P regulation of inflammatory response
GO:0060427 P lung connective tissue development
GO:0070062 C extracellular exosome
GO:0071260 P cellular response to mechanical stimulus
RNA-seq EntryA_BomoMSG_c5000_g1_i1
Sequence
(Amino Acid)
YKTKTKLTIAGLVVLVISLGLAGYFIGGADYKAAHRLANPPDPIEPLKPSASTLHVFQKA
AVCTDSPQCSQIGREILLKNGSAVDAAIAAMFCNSLRNQQSMGLGG
(34 a.a.)

- SilkBase 1999-2023 -