SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG10586_internal:A_BomoMSG_c22778_g1_i2
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)		rho-associated_protein_kinase_isoform_X1_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005815 C microtubule organizing center
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0006468 P protein phosphorylation
GO:0006939 P smooth muscle contraction
GO:0007266 P Rho protein signal transduction
GO:0010825 P positive regulation of centrosome duplication
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0017048 F small GTPase binding
GO:0030036 P actin cytoskeleton organization
GO:0032956 P regulation of actin cytoskeleton organization
GO:0035556 P intracellular signal transduction
GO:0042752 P regulation of circadian rhythm
GO:0046872 F metal ion binding
GO:0048511 P rhythmic process
RNA-seq EntryA_BomoMSG_c22778_g1_i2
Sequence
(Amino Acid)
VLFRSYVVVSSKKIIFYNSENDKQNTTDPVMILDLSKVFHVRSVTQGDVIRADAKDIPRI
FQLLYAGEGEARRPDQQDQPQDSTDHQGNTVQHKGHDLVSITYHIPTACEVCTRPLWHMF
RPPQAYECRRCRMKIHAEHLTEGE
(47 a.a.)

- SilkBase 1999-2023 -