SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG10510_5prime_partial:A_BomoMSG_c22731_g1_i3
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)
syntaxin-7_[Bombyx_mori]
Ontology
GO:0000149 F SNARE binding
GO:0001772 C immunological synapse
GO:0001916 P positive regulation of T cell mediated cytotoxicity
GO:0005484 F SNAP receptor activity
GO:0005515 F protein binding
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005768 C endosome
GO:0005769 C early endosome
GO:0005770 C late endosome
GO:0005886 C plasma membrane
GO:0006886 P intracellular protein transport
GO:0006906 P vesicle fusion
GO:0012505 C endomembrane system
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016192 P vesicle-mediated transport
GO:0019869 F chloride channel inhibitor activity
GO:0019905 F syntaxin binding
GO:0030139 C endocytic vesicle
GO:0031201 C SNARE complex
GO:0031901 C early endosome membrane
GO:0031982 C vesicle
GO:0042582 C azurophil granule
GO:0043231 C intracellular membrane-bounded organelle
GO:0048278 P vesicle docking
GO:0048471 C perinuclear region of cytoplasm
GO:0051640 P organelle localization
GO:0055037 C recycling endosome
GO:0070062 C extracellular exosome
GO:0070820 C tertiary granule
GO:0070925 P organelle assembly
GO:1902685 P positive regulation of receptor localization to synapse
GO:1903076 P regulation of protein localization to plasma membrane
RNA-seq EntryA_BomoMSG_c22731_g1_i3
Sequence
(Amino Acid)
VLFRSDVRKQEQMNMQAERSLVELEERERDIRQLESDILTVNDIFKELSTMIHAQGEVVD
SIESSVEYTAQNVESATQQLREAGNYKNKLRKKKVYLAIILIIVVSIILIVLFHN
*(37 a.a.)

- SilkBase 1999-2023 -