SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG10455_internal:A_BomoMSG_c22698_g1_i1
Scaffold_idBomo_Chr28
NCBI non-redundant
(nr)
alpha-N-acetylgalactosaminidase_isoform_X2_[Bombyx_mori]
Ontology
GO:0003824 F catalytic activity
GO:0004553 F hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004557 F alpha-galactosidase activity
GO:0005102 F signaling receptor binding
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005737 C cytoplasm
GO:0005764 C lysosome
GO:0005794 C Golgi apparatus
GO:0005975 P carbohydrate metabolic process
GO:0006687 P glycosphingolipid metabolic process
GO:0008152 P metabolic process
GO:0009311 P oligosaccharide metabolic process
GO:0016787 F hydrolase activity
GO:0016798 F hydrolase activity, acting on glycosyl bonds
GO:0016936 F galactoside binding
GO:0042803 F protein homodimerization activity
GO:0043202 C lysosomal lumen
GO:0045019 P negative regulation of nitric oxide biosynthetic process
GO:0046477 P glycosylceramide catabolic process
GO:0046479 P glycosphingolipid catabolic process
GO:0051001 P negative regulation of nitric-oxide synthase activity
GO:0052692 F raffinose alpha-galactosidase activity
GO:0070062 C extracellular exosome
RNA-seq EntryA_BomoMSG_c22698_g1_i1
Sequence
(Amino Acid)
RSEERNEGYQEAGFEYIIIDDCWSEHHRDRDGRLVPDSLRFPNGMKYISDYIHSRNLKFG
MYTNVADVTCMRYQGSKGHFKVDADTFAQWGVDYIKVDGC
(32 a.a.)

- SilkBase 1999-2023 -