SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG1041_internal:A_BomoMSG_c4826_g1_i1
Scaffold_idBomo_Chr26
NCBI non-redundant
(nr)		huntingtin_[Bombyx_mori]
Ontology
GO:0000050 P urea cycle
GO:0000052 P citrulline metabolic process
GO:0000132 P establishment of mitotic spindle orientation
GO:0002039 F p53 binding
GO:0005515 F protein binding
GO:0005522 F profilin binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005770 C late endosome
GO:0005776 C autophagosome
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005814 C centriole
GO:0005829 C cytosol
GO:0006606 P protein import into nucleus
GO:0006839 P mitochondrial transport
GO:0006888 P endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006890 P retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
GO:0006915 P apoptotic process
GO:0007005 P mitochondrion organization
GO:0007029 P endoplasmic reticulum organization
GO:0007030 P Golgi organization
GO:0007212 P dopamine receptor signaling pathway
GO:0007283 P spermatogenesis
GO:0007369 P gastrulation
GO:0007417 P central nervous system development
GO:0007420 P brain development
GO:0007569 P cell aging
GO:0007611 P learning or memory
GO:0007612 P learning
GO:0007625 P grooming behavior
GO:0007626 P locomotory behavior
GO:0008088 P axo-dendritic transport
GO:0008134 F transcription factor binding
GO:0008306 P associative learning
GO:0008340 P determination of adult lifespan
GO:0008542 P visual learning
GO:0009653 P anatomical structure morphogenesis
GO:0009952 P anterior/posterior pattern specification
GO:0016023 C cytoplasmic vesicle
GO:0016197 P endosomal transport
GO:0016234 C inclusion body
GO:0019244 P lactate biosynthetic process from pyruvate
GO:0019805 P quinolinate biosynthetic process
GO:0021756 P striatum development
GO:0021988 P olfactory lobe development
GO:0021990 P neural plate formation
GO:0022008 P neurogenesis
GO:0030072 P peptide hormone secretion
GO:0030073 P insulin secretion
GO:0030424 C axon
GO:0030425 C dendrite
GO:0030659 C cytoplasmic vesicle membrane
GO:0031587 P positive regulation of inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity
GO:0034047 P regulation of phosphoprotein phosphatase activity
GO:0034452 F dynactin binding
GO:0035176 P social behavior
GO:0042445 P hormone metabolic process
GO:0042802 F identical protein binding
GO:0043066 P negative regulation of apoptotic process
GO:0043234 C protein-containing complex
GO:0043524 P negative regulation of neuron apoptotic process
GO:0044325 F transmembrane transporter binding
GO:0045505 F dynein intermediate chain binding
GO:0045724 P positive regulation of cilium assembly
GO:0046902 P regulation of mitochondrial membrane permeability
GO:0047496 P vesicle transport along microtubule
GO:0048167 P regulation of synaptic plasticity
GO:0048341 P paraxial mesoderm formation
GO:0048487 F beta-tubulin binding
GO:0048666 P neuron development
GO:0050809 F diazepam binding
GO:0051402 P neuron apoptotic process
GO:0051592 P response to calcium ion
GO:0051881 P regulation of mitochondrial membrane potential
GO:0051938 P L-glutamate import
GO:0055072 P iron ion homeostasis
GO:0071539 P protein localization to centrosome
GO:1901215 P negative regulation of neuron death
GO:1902857 P positive regulation of non-motile cilium assembly
GO:2001237 P negative regulation of extrinsic apoptotic signaling pathway
RNA-seq EntryA_BomoMSG_c4826_g1_i1
Sequence
(Amino Acid)
LAYSGQGILGYCLDNLDYCNTNVSMRTLLLDLCRLIYPVEVHNIMRKRTASRDIFERDST
SKGKWQHLDGDRVASLAEKFLQVTLKMLNVLVHLIEEVNPNVHLNKGGIALPGSPVRRKT
QDSIQTRKNSTASESLDDKASLKRKPLMPATSLRANFVGHFYNEPFYMKLYEGLRAAYSN
HKINLDPKSSIFHTFLSTTLDCLAVQLELSTEKEFGSVTEEILYYLKAIMPLCADNTVYC
VTQLLKCLFEIGRA
(83 a.a.)

- SilkBase 1999-2023 -