SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG10393_internal:A_BomoMSG_c22657_g1_i1
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
F-actin-uncapping_protein_LRRC16A_[Bombyx_mori]
Ontology
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0007015 P actin filament organization
GO:0007596 P blood coagulation
GO:0016020 C membrane
GO:0016477 P cell migration
GO:0030027 C lamellipodium
GO:0030032 P lamellipodium assembly
GO:0030335 P positive regulation of cell migration
GO:0030838 P positive regulation of actin filament polymerization
GO:0031252 C cell leading edge
GO:0031529 P ruffle organization
GO:0031941 C filamentous actin
GO:0032403 F protein-containing complex binding
GO:0042995 C cell projection
GO:0044351 P macropinocytosis
GO:0044354 C macropinosome
GO:0046415 P urate metabolic process
GO:0051496 P positive regulation of stress fiber assembly
GO:0051638 P barbed-end actin filament uncapping
GO:0051639 P actin filament network formation
GO:0070062 C extracellular exosome
GO:1900026 P positive regulation of substrate adhesion-dependent cell spreading
GO:1902745 P positive regulation of lamellipodium organization
GO:2000813 P negative regulation of barbed-end actin filament capping
RNA-seq EntryA_BomoMSG_c22657_g1_i1
Sequence
(Amino Acid)
ALTAAFDDLFPNVPMVDIIQKVNLLFPLQNVSGTRKHLACGDFSNQYAAMCDLCQTPFRA
EVAWDIDTIYLAHDIRMLHLKDFDHLDQRDLIPLVMALQHNTWFEGICGDGVR
(36 a.a.)

- SilkBase 1999-2023 -