SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG10372_3prime_partial:A_BomoMSG_c22639_g1_i1
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)		protein_ovo_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0007010 P cytoskeleton organization
GO:0007275 P multicellular organism development
GO:0008343 P adult feeding behavior
GO:0008360 P regulation of cell shape
GO:0009913 P epidermal cell differentiation
GO:0016348 P imaginal disc-derived leg joint morphogenesis
GO:0018992 P germ-line sex determination
GO:0019099 P female germ-line sex determination
GO:0030154 P cell differentiation
GO:0035017 P cuticle pattern formation
GO:0035316 P non-sensory hair organization
GO:0042335 P cuticle development
GO:0042810 P pheromone metabolic process
GO:0043565 F sequence-specific DNA binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0048067 P cuticle pigmentation
GO:0048477 P oogenesis
GO:0070896 P positive regulation of transposon integration
RNA-seq EntryA_BomoMSG_c22639_g1_i1
Sequence
(Amino Acid)
MPKIFWIKKRLHEQQLELQEGQELLASKTDPLCPDSPLDDGPLPLLSKKDKEKECTDGDV
FGENKGTHENRTKETRRFISSILGGDIPYGHRSHVLTQAERKQYLPVLVEEIKQEDKPLV
KEEKKLIDSDPVVLPPRNSPSPESKPSPGIDNNVTCQKVSVIQRTPSQSQFRDNKKEDVT
IPTTLPPPETEQDQPIDYVIAKKRGETEDEETEKKIREQRRTSSSKIANGILARPVLVLR
NCPATKVPGMLNAAAGHGRSTGSSSSGSGSQSGTGSGSFSSGSGGAAPSSGGGGAIGGGS
GSGGNGRDGRSNYGPNSPPTGSLPPFYETLGPSTKNGQNSFNANSNFSNEF
(116 a.a.)

- SilkBase 1999-2023 -