SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG10341_internal:A_BomoMSG_c22620_g1_i1
Scaffold_idBomo_Chr27
NCBI non-redundant
(nr)		ankyrin-3_[Bombyx_mori]
Ontology
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005764 C lysosome
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0007165 P signal transduction
GO:0007528 P neuromuscular junction development
GO:0008092 F cytoskeletal protein binding
GO:0008093 F cytoskeletal anchor activity
GO:0009986 C cell surface
GO:0010628 P positive regulation of gene expression
GO:0010650 P positive regulation of cell communication by electrical coupling
GO:0010765 P positive regulation of sodium ion transport
GO:0010960 P magnesium ion homeostasis
GO:0014704 C intercalated disc
GO:0014731 C spectrin-associated cytoskeleton
GO:0016020 C membrane
GO:0016529 C sarcoplasmic reticulum
GO:0030018 C Z disc
GO:0030054 C cell junction
GO:0030315 C T-tubule
GO:0030424 C axon
GO:0030425 C dendrite
GO:0030507 F spectrin binding
GO:0030674 F protein-macromolecule adaptor activity
GO:0031594 C neuromuscular junction
GO:0033268 C node of Ranvier
GO:0034112 P positive regulation of homotypic cell-cell adhesion
GO:0042383 C sarcolemma
GO:0042995 C cell projection
GO:0043005 C neuron projection
GO:0043034 C costamere
GO:0043194 C axon initial segment
GO:0043266 P regulation of potassium ion transport
GO:0044325 F transmembrane transporter binding
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0045296 F cadherin binding
GO:0045838 P positive regulation of membrane potential
GO:0071286 P cellular response to magnesium ion
GO:0071709 P membrane assembly
GO:0072659 P protein localization to plasma membrane
GO:0072661 P protein localization to plasma membrane
GO:0090314 P positive regulation of protein targeting to membrane
GO:1900827 P positive regulation of membrane depolarization during cardiac muscle cell action potential
GO:1902260 P negative regulation of delayed rectifier potassium channel activity
GO:2000651 P positive regulation of sodium ion transmembrane transporter activity
GO:2001259 P positive regulation of cation channel activity
RNA-seq EntryA_BomoMSG_c22620_g1_i1
Sequence
(Amino Acid)
LLLKHNADPNALSANGQTPCAIADRLGYISAVEALRPVTENTLSQAVGDTGGLEGKYRVA
APELMQDTFMSDSEDEGGEVECPIQQQQQYRYMNSEVGTLHRAKPLEDTVTDGHLWPSNN
DKKVATMERQPVDIGFLVSFVVDARGGAMKAKRRGGVRIIVPPAACAAPTRVTCRAATRR
APAAAPPPLMEGEALASRLLELQPAGAKFLAPVIIEVPIFTSACRDREIVILRSDTGETW
QDHYLHNNDNPMIQEALERERQEYGNNGEALGERGERVTRIVTCDFPHYLACVSRVRQEV
HVVGPEGGTVS
(102 a.a.)

- SilkBase 1999-2023 -