SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG10319_internal:A_BomoMSG_c22597_g1_i1
Scaffold_idBomo_Chr2
NCBI non-redundant
(nr)
CLIP-associating_protein_[Bombyx_mori]
Ontology
GO:0000022 P mitotic spindle elongation
GO:0000070 P mitotic sister chromatid segregation
GO:0000775 C chromosome, centromeric region
GO:0000776 C kinetochore
GO:0000922 C spindle pole
GO:0005525 F GTP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005819 C spindle
GO:0005827 C polar microtubule
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0005875 C microtubule associated complex
GO:0005876 C spindle microtubule
GO:0007049 P cell cycle
GO:0007051 P spindle organization
GO:0007052 P mitotic spindle organization
GO:0007067 P mitotic cell cycle
GO:0007275 P multicellular organism development
GO:0007282 P cystoblast division
GO:0007411 P axon guidance
GO:0008017 F microtubule binding
GO:0016325 P oocyte microtubule cytoskeleton organization
GO:0019827 P stem cell population maintenance
GO:0030154 P cell differentiation
GO:0030426 C growth cone
GO:0030723 P ovarian fusome organization
GO:0031116 P positive regulation of microtubule polymerization
GO:0032154 C cleavage furrow
GO:0035099 P hemocyte migration
GO:0035371 C microtubule plus-end
GO:0040001 P establishment of mitotic spindle localization
GO:0042995 C cell projection
GO:0045169 C fusome
GO:0045172 C germline ring canal
GO:0046580 P negative regulation of Ras protein signal transduction
GO:0046602 P regulation of mitotic centrosome separation
GO:0048477 P oogenesis
GO:0051225 P spindle assembly
GO:0051301 P cell division
GO:0051315 P attachment of mitotic spindle microtubules to kinetochore
GO:0090307 P mitotic spindle assembly
RNA-seq EntryA_BomoMSG_c22597_g1_i1
Sequence
(Amino Acid)
ASLHAARRRPSGIPRSLAGSRETSPTRSGRSSSGVRRRESMERTAPSRAPAHTLRLLQQT
RDAEAALRSPEDSSACEGGRGRDDDSEASSVCSERSLDSYRRHDSMSWSGSGARLGWEGS
PPPPPPADDIIVLCSSTHWTERKDGLTHLANYLNSGRLLTDEQLRRLTELLNKMFVDAHT
KVFSLLLDAVCELLLVHWQQLKDWLYQLMFRLLMKLGTDILGSVQSKIMKTLDVIHECFP
AELQLHNIFRFLSDGAAAPPARTRAAALRFLAELALHYCTPG
(93 a.a.)

- SilkBase 1999-2023 -