SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG10307_internal:A_BomoMSG_c22591_g1_i4
Scaffold_idBomo_Chr17
NCBI non-redundant
(nr)
serine/threonine-protein_kinase_ATR_[Bombyx_mori]
Ontology
GO:0000077 P DNA damage checkpoint signaling
GO:0000166 F nucleotide binding
GO:0001741 C XY body
GO:0003677 F DNA binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0005794 C Golgi apparatus
GO:0006281 P DNA repair
GO:0006468 P protein phosphorylation
GO:0006974 P cellular response to DNA damage stimulus
GO:0008156 P negative regulation of DNA replication
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016605 C PML body
GO:0016740 F transferase activity
GO:0016773 F phosphotransferase activity, alcohol group as acceptor
GO:0018105 P peptidyl-serine phosphorylation
GO:0032212 P positive regulation of telomere maintenance via telomerase
GO:0032405 F MutLalpha complex binding
GO:0032407 F MutSalpha complex binding
GO:0034644 P cellular response to UV
GO:0043393 P regulation of protein binding
GO:0043517 P positive regulation of DNA damage response, signal transduction by p53 class mediator
GO:0046777 P protein autophosphorylation
GO:0070198 P protein localization to chromosome, telomeric region
GO:0071480 P cellular response to gamma radiation
GO:0090399 P replicative senescence
GO:0097694 P establishment of RNA localization to telomere
GO:1904884 P positive regulation of telomerase catalytic core complex assembly
RNA-seq EntryA_BomoMSG_c22591_g1_i4
Sequence
(Amino Acid)
RSEERPKAKLLIAKYNDETSNVDVDVNIGYYKESVEVFNQWEKSLVSLGAYYEKVSSNET
VKSPTEMWARRTLALNSYGKALQYGHKYLYQSMPRMLSIWLDVEVTASDSSMHSVLAEMT
DIIKSYSERLPLYLYLTAFSQIVSRICHPVQEVYKQL
(51 a.a.)

- SilkBase 1999-2023 -