SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG10305_internal:A_BomoMSG_c22591_g1_i2
Scaffold_idBomo_Chr17
NCBI non-redundant
(nr)
serine/threonine-protein_kinase_ATR_[Bombyx_mori]
Ontology
GO:0000076 P DNA replication checkpoint signaling
GO:0000077 P DNA damage checkpoint signaling
GO:0000166 F nucleotide binding
GO:0000706 P meiotic DNA double-strand break processing
GO:0000723 P telomere maintenance
GO:0001700 P embryonic development via the syncytial blastoderm
GO:0003677 F DNA binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0006281 P DNA repair
GO:0006468 P protein phosphorylation
GO:0006974 P cellular response to DNA damage stimulus
GO:0007015 P actin filament organization
GO:0007088 P regulation of mitotic nuclear division
GO:0007093 P mitotic cell cycle checkpoint signaling
GO:0007095 P mitotic G2 DNA damage checkpoint signaling
GO:0007126 P meiotic cell cycle
GO:0007131 P reciprocal meiotic recombination
GO:0007275 P multicellular organism development
GO:0007348 P regulation of syncytial blastoderm mitotic cell cycle
GO:0007349 P cellularization
GO:0007444 P imaginal disc development
GO:0008360 P regulation of cell shape
GO:0009314 P response to radiation
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016321 P female meiosis chromosome segregation
GO:0016740 F transferase activity
GO:0016773 F phosphotransferase activity, alcohol group as acceptor
GO:0018105 P peptidyl-serine phosphorylation
GO:0030261 P chromosome condensation
GO:0031000 P response to caffeine
GO:0033314 P mitotic DNA replication checkpoint signaling
GO:0045002 P double-strand break repair via single-strand annealing
GO:0045003 P double-strand break repair via synthesis-dependent strand annealing
GO:0048477 P oogenesis
RNA-seq EntryA_BomoMSG_c22591_g1_i2
Sequence
(Amino Acid)
GDRRSNVIINQLLDEWRRRISVVQSDVRTIEPLLRLRRIVLQQAKEILEPSHPMTANTLK
SFIVDLWLQSAKHARKAGIFQQAYMYILNAEEYHPEELFIEKSKMYWARGQNEQAFITLR
RGLEDSYPAIETLSKEQRKICAKAKLLIAKYNDETSNVDVDVNIGYYKESVEVFNQWEKS
LVSLGAYYEKVSSNETVKSPTEMWARRTLALNSYGKALQYGHKYLYQSMPRMLSIWLDVE
VTASDSSMHSVLAEMTDIIKSYSERLPLYLYLTAFSQIVSRICHPVQEVYKQL
(96 a.a.)

- SilkBase 1999-2023 -