SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG10202_3prime_partial:A_BomoMSG_c22515_g1_i1
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)		LIM_domain_transcription_factor_LMO4_[Bombyx_mori]
Ontology
GO:0001158 F cis-regulatory region sequence-specific DNA binding
GO:0001843 P neural tube closure
GO:0003281 P ventricular septum development
GO:0005515 F protein binding
GO:0005667 C transcription regulator complex
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0008134 F transcription factor binding
GO:0008270 F zinc ion binding
GO:0021514 P ventral spinal cord interneuron differentiation
GO:0021522 P spinal cord motor neuron differentiation
GO:0021527 P spinal cord association neuron differentiation
GO:0030334 P regulation of cell migration
GO:0031252 C cell leading edge
GO:0031333 P negative regulation of protein-containing complex assembly
GO:0033674 P positive regulation of kinase activity
GO:0042659 P regulation of cell fate specification
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0048538 P thymus development
GO:0050865 P regulation of cell activation
RNA-seq EntryA_BomoMSG_c22515_g1_i1
Sequence
(Amino Acid)
MNPHYHGYAELSSPHPSSPEASFAANGHDYPHNNNNPALKECAGCGGKIVERFLLHALDR
YWHHGCLKCTCCGQALADMGRSFYFKGGMILCKNDYTRMFGSGGACAACGQAIPASEFVM
RTNAPQQPLHVFHIKCFACSKCGSHLLQGDRK
(49 a.a.)

- SilkBase 1999-2023 -