SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG1018_3prime_partial:A_BomoMSG_c4721_g1_i1
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)		cell_division_cycle_7-related_protein_kinase_[Bombyx_mori]
Ontology
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0000166 F nucleotide binding
GO:0000727 P double-strand break repair via break-induced replication
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0006260 P DNA replication
GO:0006270 P DNA replication initiation
GO:0006468 P protein phosphorylation
GO:0006909 P phagocytosis
GO:0007049 P cell cycle
GO:0008284 P positive regulation of cell population proliferation
GO:0008360 P regulation of cell shape
GO:0010571 P positive regulation of nuclear cell cycle DNA replication
GO:0010971 P positive regulation of G2/M transition of mitotic cell cycle
GO:0015630 C microtubule cytoskeleton
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018105 P peptidyl-serine phosphorylation
GO:0044770 P cell cycle phase transition
GO:0045171 C intercellular bridge
GO:0046872 F metal ion binding
GO:0051301 P cell division
RNA-seq EntryA_BomoMSG_c4721_g1_i1
Sequence
(Amino Acid)
MSRSRGFEIREGLRSHKKLKENKNENETSDSSEREQICELLYKLPKLDKIFEVHRKIGEG
TFSSVYLGSLRQHSSLLDKDKRWFAIKHLVPTAHPARIEHELRCLQDIGGKHHVIGVELC
LRNLDTIVFVMPYLPHKKFSEYVGDMDAAELREYMRALLEAL
(53 a.a.)

- SilkBase 1999-2023 -