| Name | O_BomoMSG10157_5prime_partial:A_BomoMSG_c22495_g1_i2 |
| Scaffold_id | Bomo_Chr22 |
NCBI non-redundant
(nr) | putative_adaptor_protein_enigma_[Operophtera_brumata] |
| Ontology |
| GO:0001725 |
C |
stress fiber |
| GO:0001952 |
P |
regulation of cell-matrix adhesion |
| GO:0003779 |
F |
actin binding |
| GO:0005515 |
F |
protein binding |
| GO:0005737 |
C |
cytoplasm |
| GO:0005856 |
C |
cytoskeleton |
| GO:0005915 |
C |
zonula adherens |
| GO:0005925 |
C |
focal adhesion |
| GO:0005927 |
C |
muscle tendon junction |
| GO:0008270 |
F |
zinc ion binding |
| GO:0015629 |
C |
actin cytoskeleton |
| GO:0016323 |
C |
basolateral plasma membrane |
| GO:0030018 |
C |
Z disc |
| GO:0030239 |
P |
myofibril assembly |
| GO:0031252 |
C |
cell leading edge |
| GO:0045177 |
C |
apical part of cell |
| GO:0045178 |
C |
basal part of cell |
| GO:0046872 |
F |
metal ion binding |
| GO:0051371 |
F |
muscle alpha-actinin binding |
| GO:0061061 |
P |
muscle structure development |
|
| RNA-seq Entry | A_BomoMSG_c22495_g1_i2 |
Sequence
(Amino Acid) | DRKSVVPTQEMLSVNSSNYLNNENNATASRNTGIYKPKPLNSGANQGPVCDPTPSTGSSV
GAATRGKTFGVSSAPKRGRGILNKPALPGSRVPLCASCNGNIR
*(33 a.a.) |
