SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG10144_internal:A_BomoMSG_c22493_g1_i3
Scaffold_idBomo_Chr2
NCBI non-redundant
(nr)		mothers_against_decapentaplegic_homolog_3_[Bombyx_mori]
Ontology
GO:0000790 C chromatin
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001657 P ureteric bud development
GO:0001701 P in utero embryonic development
GO:0001706 P endoderm formation
GO:0001707 P mesoderm formation
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003690 F double-stranded DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005160 F transforming growth factor beta receptor binding
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005667 C transcription regulator complex
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0006468 P protein phosphorylation
GO:0007179 P transforming growth factor beta receptor signaling pathway
GO:0007182 P common-partner SMAD protein phosphorylation
GO:0007183 P SMAD protein complex assembly
GO:0007352 P zygotic specification of dorsal/ventral axis
GO:0007369 P gastrulation
GO:0007389 P pattern specification process
GO:0007492 P endoderm development
GO:0007507 P heart development
GO:0008134 F transcription factor binding
GO:0008285 P negative regulation of cell population proliferation
GO:0009749 P response to glucose
GO:0009791 P post-embryonic development
GO:0009880 P embryonic pattern specification
GO:0009952 P anterior/posterior pattern specification
GO:0010628 P positive regulation of gene expression
GO:0010629 P negative regulation of gene expression
GO:0010718 P positive regulation of epithelial to mesenchymal transition
GO:0017015 P regulation of transforming growth factor beta receptor signaling pathway
GO:0019902 F phosphatase binding
GO:0023019 P signal transduction involved in regulation of gene expression
GO:0030073 P insulin secretion
GO:0030324 P lung development
GO:0030513 P positive regulation of BMP signaling pathway
GO:0030618 F obsolete transforming growth factor beta receptor, pathway-specific cytoplasmic mediator activity
GO:0031016 P pancreas development
GO:0031625 F ubiquitin protein ligase binding
GO:0032444 C activin responsive factor complex
GO:0032924 P activin receptor signaling pathway
GO:0033613 F DNA-binding transcription factor binding
GO:0034713 F type I transforming growth factor beta receptor binding
GO:0035265 P organ growth
GO:0035556 P intracellular signal transduction
GO:0038092 P nodal signaling pathway
GO:0042803 F protein homodimerization activity
GO:0043234 C protein-containing complex
GO:0045165 P cell fate commitment
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046332 F SMAD binding
GO:0046872 F metal ion binding
GO:0046982 F protein heterodimerization activity
GO:0048340 P paraxial mesoderm morphogenesis
GO:0048589 P developmental growth
GO:0048617 P embryonic foregut morphogenesis
GO:0048701 P embryonic cranial skeleton morphogenesis
GO:0051098 P regulation of binding
GO:0060021 P roof of mouth development
GO:0060039 P pericardium development
GO:0060395 P SMAD protein signal transduction
GO:0070410 F co-SMAD binding
GO:0070411 F I-SMAD binding
GO:0070412 F R-SMAD binding
GO:0070723 P response to cholesterol
GO:0071141 C SMAD protein complex
GO:0071144 C heteromeric SMAD protein complex
GO:1900224 P positive regulation of nodal signaling pathway involved in determination of lateral mesoderm left/right asymmetry
RNA-seq EntryA_BomoMSG_c22493_g1_i3
Sequence
(Amino Acid)
RKSVQYRKGLPHVVYCRLWRWPQLQSQHELKPVDHCEYAYQLKKDEVCINPYHYNKIDSP
ALPPILVRRCSEGEVRAPPPYADYHQPILHEHPDVAMQSGTGHSALYLEATLAQHVPGNT
TVHVSSSTVETPPPGYISEDGDPMDQIGRAS
(49 a.a.)

- SilkBase 1999-2023 -