SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG10057_5prime_partial:A_BomoMSG_c22419_g1_i1
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)		uncharacterized_protein_LOC101745986_isoform_X3_[Bombyx_mori]
Ontology
GO:0002039 F p53 binding
GO:0004842 F ubiquitin-protein transferase activity
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006915 P apoptotic process
GO:0008270 F zinc ion binding
GO:0012505 C endomembrane system
GO:0016020 C membrane
GO:0016567 P protein ubiquitination
GO:0016607 C nuclear speck
GO:0016874 F ligase activity
GO:0031625 F ubiquitin protein ligase binding
GO:0035872 P nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0046872 F metal ion binding
GO:0061630 F ubiquitin protein ligase activity
GO:0070417 P cellular response to cold
GO:0070936 P protein K48-linked ubiquitination
GO:1901797 P negative regulation of signal transduction by p53 class mediator
GO:1901981 F phosphatidylinositol phosphate binding
GO:1902042 P negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:2000374 P regulation of oxygen metabolic process
GO:2001271 P negative regulation of cysteine-type endopeptidase activity involved in execution phase of apoptosis
RNA-seq EntryA_BomoMSG_c22419_g1_i1
Sequence
(Amino Acid)
DLGSEAALEALSVRQLKRLLLRHRVEYRGAIERADLLERARTLWRGQRAHAADPELLPLE
DACKICMAARLECVLLECGHIATCTQCSSRLAECPICRRFVVRAVRFFRS
*(36 a.a.)

- SilkBase 1999-2023 -