SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG1000_internal:A_BomoMSG_c4653_g1_i1
Scaffold_idBomo_Chr19
NCBI non-redundant
(nr)
epidermal_growth_factor_receptor_substrate_15-like_1_[Bombyx_mori]
Ontology
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005905 C clathrin-coated pit
GO:0006810 P transport
GO:0006895 P Golgi to endosome transport
GO:0006897 P endocytosis
GO:0007173 P epidermal growth factor receptor signaling pathway
GO:0008283 P cell population proliferation
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016050 P vesicle organization
GO:0016235 C aggresome
GO:0017124 F SH3 domain binding
GO:0019065 P receptor-mediated endocytosis of virus by host cell
GO:0030122 C AP-2 adaptor complex
GO:0030132 C clathrin coat of coated pit
GO:0030136 C clathrin-coated vesicle
GO:0031593 F polyubiquitin modification-dependent protein binding
GO:0031901 C early endosome membrane
GO:0032456 P endocytic recycling
GO:0042059 P negative regulation of epidermal growth factor receptor signaling pathway
GO:0042802 F identical protein binding
GO:0043231 C intracellular membrane-bounded organelle
GO:0046718 P viral entry into host cell
GO:0046872 F metal ion binding
GO:0048268 P clathrin coat assembly
GO:0060170 C ciliary membrane
RNA-seq EntryA_BomoMSG_c4653_g1_i1
Sequence
(Amino Acid)
PAASPALGDWSMKPHERDKYSQLFDSLQPTNGLIPGAKVKGVLMESKLPLETLGKIWDLA
DQDRDGMLDRHEFMVLCFHFVGDAFGIQGARETRGAHEPAPRAADSAQI
(35 a.a.)

- SilkBase 1999-2023 -