SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG95_internal:A_BomoMG_comp17174_c0_seq1
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)		PREDICTED:_zinc_finger_protein_239-like_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001078 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0010629 P negative regulation of gene expression
GO:0032728 P positive regulation of interferon-beta production
GO:0032755 P positive regulation of interleukin-6 production
GO:0032760 P positive regulation of tumor necrosis factor production
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
RNA-seq EntryA_BomoMG_comp17174_c0_seq1
Sequence
(Amino Acid)
GSLCQSFKCNLCFRGFVFEQAYVNHKMKHDQVNGPHQCPVCKMHYRTQRHLRVHSVTAHE
RLYRCNKCGTISHTMNQARDHEKWHNGHTYECLLCGMKFRKPT
(33 a.a.)

- SilkBase 1999-2023 -