SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG81_internal:A_BomoMG_comp17114_c0_seq1
Scaffold_idBomo_Chr6
NCBI non-redundant
(nr)
PREDICTED:_peripheral_plasma_membrane_protein_CASK-like_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0001953 P negative regulation of cell-matrix adhesion
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005516 F calmodulin binding
GO:0005524 F ATP binding
GO:0005604 C basement membrane
GO:0005634 C nucleus
GO:0005652 C nuclear lamina
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005911 C cell-cell junction
GO:0005925 C focal adhesion
GO:0006468 P protein phosphorylation
GO:0010839 P negative regulation of keratinocyte proliferation
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016323 C basolateral plasma membrane
GO:0016363 C nuclear matrix
GO:0016740 F transferase activity
GO:0031982 C vesicle
GO:0042043 F neurexin family protein binding
GO:0045202 C synapse
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0061045 P negative regulation of wound healing
GO:0070509 P calcium ion import
GO:0090280 P positive regulation of calcium ion import
GO:0090288 P negative regulation of cellular response to growth factor stimulus
RNA-seq EntryA_BomoMG_comp17114_c0_seq1
Sequence
(Amino Acid)
HNAVFDQLDVVTYEEVVKLPSFQRKTLVLLGAHGVGRRHIKNTLIARHPDLYAYPIPHTT
RPPRPDEESNRQYYFISHDEMMADIAANEYLEYGTHEDAMYGTKIETIRRIHAERRVAIL
DVEPQALKILRTAEFAPFVVLVASPEPHTVSEVSTPTAPCARAV
(53 a.a.)

- SilkBase 1999-2023 -