SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG75_internal:A_BomoMG_comp17102_c0_seq1
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)		PREDICTED:_receptor-type_tyrosine-protein_phosphatase_N2_isoform_X2_[Bombyx_mori]
Ontology
GO:0004721 F phosphoprotein phosphatase activity
GO:0004725 F protein tyrosine phosphatase activity
GO:0005001 F transmembrane receptor protein tyrosine phosphatase activity
GO:0005737 C cytoplasm
GO:0005788 C endoplasmic reticulum lumen
GO:0005887 C integral component of plasma membrane
GO:0006470 P protein dephosphorylation
GO:0007269 P neurotransmitter secretion
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016311 P dephosphorylation
GO:0016787 F hydrolase activity
GO:0016791 F phosphatase activity
GO:0030054 C cell junction
GO:0030141 C secretory granule
GO:0030658 C transport vesicle membrane
GO:0030667 C secretory granule membrane
GO:0030672 C synaptic vesicle membrane
GO:0031410 C cytoplasmic vesicle
GO:0034260 P negative regulation of GTPase activity
GO:0035335 P peptidyl-tyrosine dephosphorylation
GO:0035773 P insulin secretion involved in cellular response to glucose stimulus
GO:0043195 C terminal bouton
GO:0043235 C receptor complex
GO:0045202 C synapse
RNA-seq EntryA_BomoMG_comp17102_c0_seq1
Sequence
(Amino Acid)
RQALWALALINALAPSHADGNIGCLFSAPLCVEGVEWCYDDFAFGKCIPVYEEESEEGAL
YRYDMGPEQLQWFEGELQRLAARGYRWEHAYTQCVLQAMLLTLQQNIDLSNVNTKICEHF
AD
(39 a.a.)

- SilkBase 1999-2023 -