| Name | O_BomoMG68_internal:A_BomoMG_comp17078_c0_seq2 |
| Scaffold_id | Bomo_Chr16 |
NCBI non-redundant
(nr) | FancJ-like_protein_[Bombyx_mori] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0003676 |
F |
nucleic acid binding |
| GO:0003677 |
F |
DNA binding |
| GO:0003678 |
F |
DNA helicase activity |
| GO:0004003 |
F |
DNA helicase activity |
| GO:0004386 |
F |
helicase activity |
| GO:0005524 |
F |
ATP binding |
| GO:0005634 |
C |
nucleus |
| GO:0005654 |
C |
nucleoplasm |
| GO:0005737 |
C |
cytoplasm |
| GO:0006139 |
P |
nucleobase-containing compound metabolic process |
| GO:0006281 |
P |
DNA repair |
| GO:0006357 |
P |
regulation of transcription by RNA polymerase II |
| GO:0006974 |
P |
cellular response to DNA damage stimulus |
| GO:0008026 |
F |
helicase activity |
| GO:0016787 |
F |
hydrolase activity |
| GO:0016818 |
F |
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides |
| GO:0031965 |
C |
nuclear membrane |
| GO:0032508 |
P |
DNA duplex unwinding |
| GO:0046872 |
F |
metal ion binding |
| GO:0051536 |
F |
iron-sulfur cluster binding |
| GO:0051539 |
F |
4 iron, 4 sulfur cluster binding |
|
| RNA-seq Entry | A_BomoMG_comp17078_c0_seq2 |
Sequence
(Amino Acid) | KSDSPPKHYAMSSGSPDTNTMGTHGATSIDEEQSQTRKKYKAENITNISDSPRSPSNSQN
PPKHERVPVVYYGTRTHKQLQQVIKEFKRTVYCKEIRMSILAGRDRTCLMPFDRKIWKTK
DDMCAECIKTKSSLMNTSSPQTSSCKFYDNRMSLTHSNLPPAFDIEDLVEAGAKLKACPY
FAAKSMAAKAKIIFCPYNYLINPFIRERMRI
(69 a.a.) |
