| Name | O_BomoMG627_internal:A_BomoMG_comp18864_c0_seq1 |
| Scaffold_id | Bomo_Chr9 |
NCBI non-redundant
(nr) | Contactin_[Operophtera_brumata] |
| Ontology |
| GO:0003674 |
F |
molecular_function |
| GO:0005886 |
C |
plasma membrane |
| GO:0005918 |
C |
septate junction |
| GO:0007155 |
P |
cell adhesion |
| GO:0008366 |
P |
axon ensheathment |
| GO:0016020 |
C |
membrane |
| GO:0019991 |
P |
septate junction assembly |
| GO:0021682 |
P |
nerve maturation |
| GO:0030054 |
C |
cell junction |
| GO:0031225 |
C |
anchored component of membrane |
| GO:0045197 |
P |
establishment or maintenance of epithelial cell apical/basal polarity |
| GO:0060857 |
P |
establishment of glial blood-brain barrier |
| GO:0061343 |
P |
cell adhesion involved in heart morphogenesis |
|
| RNA-seq Entry | A_BomoMG_comp18864_c0_seq1 |
Sequence
(Amino Acid) | NYPEGSQNNTQYRPGPQIPYGSFPVNNEYQQPPQSSFYQDSLYNSDSYAENENDVENTAS
VYAGLDYEEKYRCPPNWLRYKESCYRFTKSPDRPRNEARKICQAYEADLVAVNSP
(37 a.a.) |
